Lineage for d2j03d2 (2j03 D:2-126)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059387Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2059775Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 2059900Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
    incomplete OB-fold lacking the last strand
  7. 2059979Species Thermus thermophilus [TaxId:274] [159084] (6 PDB entries)
    Uniprot Q72I07 1-125
  8. 2059980Domain d2j03d2: 2j03 D:2-126 [145592]
    Other proteins in same PDB: d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1
    protein/RNA complex
    protein/RNA complex

Details for d2j03d2

PDB Entry: 2j03 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.
PDB Compounds: (D:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2j03d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j03d2 b.40.4.5 (D:2-126) N-terminal domain of ribosomal protein L2 {Thermus thermophilus [TaxId: 274]}
avkkfkpytpsrrfmtvadfseitktepekslvkplkktggrnnqgritvrfrggghkrl
yriidfkrwdkvgipakvaaieydpnrsariallhyvdgekryiiapdglqvgqqvvagp
dapiq

SCOPe Domain Coordinates for d2j03d2:

Click to download the PDB-style file with coordinates for d2j03d2.
(The format of our PDB-style files is described here.)

Timeline for d2j03d2: