SCOP 1.75: Domain d2j03d1: 2j03 D:127-273

Lineage for d2j03d1 (2j03 D:127-273)

Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds)
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families)
many known members contain KOW motif
Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)
Species Thermus thermophilus [TaxId:274] [159026] (5 PDB entries)
Uniprot Q72I07 126-272

Domain d2j03d1: 2j03 D:127-273 [145591]
Other proteins in same PDB: d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1
automatically matched to 2J01 D:127-273
complexed with lys

Details for d2j03d1

PDB Entry: 2j03 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.

PDB Compounds: (D:) 50S ribosomal protein L2

SCOP Domain Sequences for d2j03d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j03d1 b.34.5.3 (D:127-273) C-terminal domain of ribosomal protein L2 {Thermus thermophilus [TaxId: 274]}
vgnalplrfipvgtvvhavelepkkgaklaraagtsaqiqgregdyvilrlpsgelrkvh
gecyatvgavgnadhknivlgkagrsrwlgrrphvrgaamnpvdhphgggegraprgrpp
aspwgwqtkglktrkrrkpssrfiiar

SCOP Domain Coordinates for d2j03d1:

Click to download the PDB-style file with coordinates for d2j03d1.
(The format of our PDB-style files is described here.)

Timeline for d2j03d1: