SCOPe 2.06: Domain d2j0371: 2j03 7:1-49

Lineage for d2j0371 (2j03 7:1-49)

1. Root: SCOPe 2.06

2. Class j: Peptides [58231] (133 folds)

3. Fold j.118: Ribosomal protein L34p [144320] (1 superfamily)
   non-globular, mainly alpha-helical

4. Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family)

5. Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein)
   Pfam PF00468

6. Protein Ribosomal protein L34p [144323] (3 species)

7. Species Thermus thermophilus [TaxId:274] [161306] (15 PDB entries)
   Uniprot P80340 1-49

8. Domain d2j0371: 2j03 7:1-49 [145589]
   Other proteins in same PDB: d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0361, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1
   protein/RNA complex
   protein/RNA complex

Details for d2j0371

PDB Entry: 2j03, 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.

PDB Compounds: (7:) 50S ribosomal protein L34

SCOPe Domain Sequences for d2j0371:

Sequence; same for both SEQRES and ATOM records:

>d2j0371 j.118.1.1 (7:1-49) Ribosomal protein L34p {Thermus thermophilus [TaxId: 274]}
mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrkr

Timeline for d2j0371:

• d2j0371 first appeared in SCOP 1.75
  
• d2j0371 appears in SCOPe 2.05
  
• d2j0371 appears in SCOPe 2.07
  
• d2j0371 appears in the current release, SCOPe 2.08