SCOP 1.75: Domain d2j0361: 2j03 6:9-53

Lineage for d2j0361 (2j03 6:9-53)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.6: Ribosomal protein L33p [144203] (1 protein)
   Pfam PF00471; corresponds structurally and functionally to the ribosomal L44e from eukaryota and archaea; metal ion-binding site is lost in most members

6. Protein Ribosomal protein L33p [144204] (3 species)

7. Species Thermus thermophilus [TaxId:274] [161180] (9 PDB entries)
   Uniprot P35871 8-52

8. Domain d2j0361: 2j03 6:9-53 [145588]
   Other proteins in same PDB: d2j0311, d2j0321, d2j0331, d2j0341, d2j0351, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1
   automatically matched to 2J01 6:9-53
   complexed with lys

Details for d2j0361

PDB Entry: 2j03, 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.

PDB Compounds: (6:) 50S ribosomal protein L33

SCOP Domain Sequences for d2j0361:

Sequence; same for both SEQRES and ATOM records:

>d2j0361 g.41.8.6 (6:9-53) Ribosomal protein L33p {Thermus thermophilus [TaxId: 274]}
lllecteckrrnyateknkrntpnklelrkycpwcrkhtvhrevk

Timeline for d2j0361:

• d2j0361 is new in SCOP 1.75
  
• d2j0361 appears in SCOPe 2.01
  
• d2j0361 appears in the current release, SCOPe 2.08