Lineage for d2j0351 (2j03 5:2-60)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705786Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1706394Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1706546Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein)
    Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail
  6. 1706547Protein Ribosomal protein L32p [144201] (3 species)
  7. 1706583Species Thermus thermophilus [TaxId:274] [161177] (11 PDB entries)
    Uniprot P80339 1-59
  8. 1706584Domain d2j0351: 2j03 5:2-60 [145587]
    Other proteins in same PDB: d2j0311, d2j0321, d2j0331, d2j0341, d2j0361, d2j0371, d2j0381, d2j03c1, d2j03d1, d2j03d2, d2j03e1, d2j03f1, d2j03g1, d2j03h1, d2j03h2, d2j03i1, d2j03i2, d2j03n1, d2j03o1, d2j03p1, d2j03q1, d2j03r1, d2j03s1, d2j03t1, d2j03u1, d2j03v1, d2j03w1, d2j03x1, d2j03y1, d2j03z1
    automatically matched to 2J01 5:2-60
    protein/RNA complex

Details for d2j0351

PDB Entry: 2j03 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50S subunit from molecule II.
PDB Compounds: (5:) 50S ribosomal protein L32

SCOPe Domain Sequences for d2j0351:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0351 g.41.8.5 (5:2-60) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]}
akhpvpkkktskarrdarrshhaltpptlvpcpeckamkpphtvcpecgyyagrkvlev

SCOPe Domain Coordinates for d2j0351:

Click to download the PDB-style file with coordinates for d2j0351.
(The format of our PDB-style files is described here.)

Timeline for d2j0351: