Lineage for d2j01u1 (2j01 U:2-118)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1751697Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 1751735Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) (S)
    automatically mapped to Pfam PF00453
  5. 1751736Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein)
  6. 1751737Protein Ribosomal protein L20 [74733] (4 species)
  7. 1751777Species Thermus thermophilus [TaxId:274] [158510] (15 PDB entries)
    Uniprot P60491 1-117
  8. 1751779Domain d2j01u1: 2j01 U:2-118 [145577]
    Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1
    Representative structure
    protein/RNA complex
    protein/RNA complex

Details for d2j01u1

PDB Entry: 2j01 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (PART 2 of 4). This file contains the 50S subunit from molecule I.
PDB Compounds: (U:) 50S ribosomal protein L20

SCOPe Domain Sequences for d2j01u1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j01u1 a.144.2.1 (U:2-118) Ribosomal protein L20 {Thermus thermophilus [TaxId: 274]}
praktgvvrrrkhkkilklakgywglrsksfrkaretlfaagnyayahrkrrkrdfrrlw
ivrinaacrqhglnystfihglkkagievdrknladlavrepqvfaelverakaaqg

SCOPe Domain Coordinates for d2j01u1:

Click to download the PDB-style file with coordinates for d2j01u1.
(The format of our PDB-style files is described here.)

Timeline for d2j01u1: