Lineage for d2j01q1 (2j01 Q:6-141)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1410866Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 1411076Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) (S)
  5. 1411141Family d.41.4.2: Ribosomal protein L16p [117888] (1 protein)
    Pfam PF00252
  6. 1411142Protein Ribosomal protein L16p [117889] (4 species)
  7. 1411182Species Thermus thermophilus [TaxId:274] [160197] (5 PDB entries)
  8. 1411184Domain d2j01q1: 2j01 Q:6-141 [145573]
    Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1
    automatically matched to d1wkia_
    protein/RNA complex

Details for d2j01q1

PDB Entry: 2j01 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (PART 2 of 4). This file contains the 50S subunit from molecule I.
PDB Compounds: (Q:) 50S ribosomal protein L16

SCOPe Domain Sequences for d2j01q1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j01q1 d.41.4.2 (Q:6-141) Ribosomal protein L16p {Thermus thermophilus [TaxId: 274]}
rmkyrkqqrgrlkgatkggdyvafgdyglvalepawitaqqieaarvamvrhfrrggkif
irifpdkpytkkplevrmgkgkgnvegyvavvkpgrvmfevagvteeqamealriaghkl
piktkivrrdaydeaq

SCOPe Domain Coordinates for d2j01q1:

Click to download the PDB-style file with coordinates for d2j01q1.
(The format of our PDB-style files is described here.)

Timeline for d2j01q1: