Lineage for d2j01h2 (2j01 H:83-171)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1432788Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 1432789Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
    automatically mapped to Pfam PF00347
  5. 1432790Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 1432791Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 1432946Species Thermus thermophilus [TaxId:274] [160797] (15 PDB entries)
    Uniprot Q72I19 11-81! Uniprot Q72I19 82-170
  8. 1432950Domain d2j01h2: 2j01 H:83-171 [145570]
    Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1
    Representative structure
    protein/RNA complex

Details for d2j01h2

PDB Entry: 2j01 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (PART 2 of 4). This file contains the 50S subunit from molecule I.
PDB Compounds: (H:) 50S ribosomal protein L6

SCOPe Domain Sequences for d2j01h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j01h2 d.141.1.1 (H:83-171) Ribosomal protein L6 {Thermus thermophilus [TaxId: 274]}
yskellikgigyrarlvgraleltvgfshpvvveppegitfevpeptrvrvsgidkqkvg
qvaanirairkpsayhekgiyyagepvrl

SCOPe Domain Coordinates for d2j01h2:

Click to download the PDB-style file with coordinates for d2j01h2.
(The format of our PDB-style files is described here.)

Timeline for d2j01h2: