Lineage for d2j01e1 (2j01 E:1-205)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1791673Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1791735Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1791909Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
    automatically mapped to Pfam PF00297
  6. 1791910Protein Ribosomal protein L3 [50462] (4 species)
    superfamily fold is elaborated with additional structures
  7. 1792010Species Thermus thermophilus [TaxId:274] [159158] (11 PDB entries)
    Uniprot Q72I04 1-205
  8. 1792012Domain d2j01e1: 2j01 E:1-205 [145566]
    Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d1, d2j01d2, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1
    Representative structure
    protein/RNA complex
    protein/RNA complex

Details for d2j01e1

PDB Entry: 2j01 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (PART 2 of 4). This file contains the 50S subunit from molecule I.
PDB Compounds: (E:) 50S ribosomal protein L3

SCOPe Domain Sequences for d2j01e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j01e1 b.43.3.2 (E:1-205) Ribosomal protein L3 {Thermus thermophilus [TaxId: 274]}
mkgilgvkvgmtrifrddravpvtvilagpcpvvqrrtpekdgytavqlgflpqnpkrvn
rplkghfakagvepvrilreirdfnpegdtvtveifkpgervdvtgtskgrgfagvmkrw
nfaggpdshgahkihrhpgsignrktpgrvykgkkmaghygaervtvmnlevvdvipeen
lllvkgavpgpngglvivretkkaa

SCOPe Domain Coordinates for d2j01e1:

Click to download the PDB-style file with coordinates for d2j01e1.
(The format of our PDB-style files is described here.)

Timeline for d2j01e1: