Lineage for d2j01d2 (2j01 D:2-126)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1788689Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1789071Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1789194Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
    incomplete OB-fold lacking the last strand
  7. 1789273Species Thermus thermophilus [TaxId:274] [159084] (6 PDB entries)
    Uniprot Q72I07 1-125
  8. 1789275Domain d2j01d2: 2j01 D:2-126 [145565]
    Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d1, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1
    Representative structure
    protein/RNA complex
    protein/RNA complex

Details for d2j01d2

PDB Entry: 2j01 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (PART 2 of 4). This file contains the 50S subunit from molecule I.
PDB Compounds: (D:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2j01d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j01d2 b.40.4.5 (D:2-126) N-terminal domain of ribosomal protein L2 {Thermus thermophilus [TaxId: 274]}
avkkfkpytpsrrfmtvadfseitktepekslvkplkktggrnnqgritvrfrggghkrl
yriidfkrwdkvgipakvaaieydpnrsariallhyvdgekryiiapdglqvgqqvvagp
dapiq

SCOPe Domain Coordinates for d2j01d2:

Click to download the PDB-style file with coordinates for d2j01d2.
(The format of our PDB-style files is described here.)

Timeline for d2j01d2: