SCOPe 2.06: Domain d2j0181: 2j01 8:2-65

Lineage for d2j0181 (2j01 8:2-65)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.301: L35p-like [143033] (1 superfamily)
   core: alpha-beta(3)-alpha; 2layers a/b

4. Superfamily d.301.1: L35p-like [143034] (1 family)
   automatically mapped to Pfam PF01632

5. Family d.301.1.1: Ribosomal protein L35p [143035] (1 protein)
   Pfam PF01632

6. Protein Ribosomal protein L35p [143036] (3 species)

7. Species Thermus thermophilus [TaxId:274] [160057] (9 PDB entries)
   Uniprot P80341 1-64

8. Domain d2j0181: 2j01 8:2-65 [145563]
   Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0171, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1
   Representative structure
   protein/RNA complex
   protein/RNA complex

Details for d2j0181

PDB Entry: 2j01, 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (PART 2 of 4). This file contains the 50S subunit from molecule I.

PDB Compounds: (8:) 50S ribosomal protein L35

SCOPe Domain Sequences for d2j0181:

Sequence; same for both SEQRES and ATOM records:

>d2j0181 d.301.1.1 (8:2-65) Ribosomal protein L35p {Thermus thermophilus [TaxId: 274]}
pkmkthkgakkrvkitasgkvvamktgkrhlnwqksgkeirqkgrkfvlakpeaerikll
lpye

Timeline for d2j0181:

• d2j0181 first appeared in SCOP 1.75
  
• d2j0181 appears in SCOPe 2.05
  
• d2j0181 appears in SCOPe 2.07
  
• d2j0181 appears in the current release, SCOPe 2.08