SCOPe 2.02: Domain d2j0171: 2j01 7:1-49

Lineage for d2j0171 (2j01 7:1-49)

1. Root: SCOPe 2.02

2. Class j: Peptides [58231] (120 folds)

3. Fold j.118: Ribosomal protein L34p [144320] (1 superfamily)
   non-globular, mainly alpha-helical

4. Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family)

5. Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein)
   Pfam PF00468

6. Protein Ribosomal protein L34p [144323] (3 species)

7. Species Thermus thermophilus [TaxId:274] [161306] (15 PDB entries)
   Uniprot P80340 1-49

8. Domain d2j0171: 2j01 7:1-49 [145562]
   Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0181, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1
   Representative structure
   protein/RNA complex

Details for d2j0171

PDB Entry: 2j01, 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (PART 2 of 4). This file contains the 50S subunit from molecule I.

PDB Compounds: (7:) 50S ribosomal protein L34

SCOPe Domain Sequences for d2j0171:

Sequence; same for both SEQRES and ATOM records:

>d2j0171 j.118.1.1 (7:1-49) Ribosomal protein L34p {Thermus thermophilus [TaxId: 274]}
mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrkr

Timeline for d2j0171:

• d2j0171 first appeared in SCOP 1.75
  
• d2j0171 appears in SCOPe 2.01
  
• d2j0171 appears in SCOPe 2.03
  
• d2j0171 appears in the current release, SCOPe 2.08