Lineage for d2izva1 (2izv A:386-429)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2351820Fold a.271: SOCS box-like [158234] (1 superfamily)
    helix-loop-helix motif with orthogonally packed helices
  4. 2351821Superfamily a.271.1: SOCS box-like [158235] (2 families) (S)
  5. 2351822Family a.271.1.1: SOCS box-like [158236] (2 proteins)
    Pfam PF07525
  6. 2351832Protein Suppressor of cytokine signaling 4, SOCS-4 [158237] (1 species)
  7. 2351833Species Human (Homo sapiens) [TaxId:9606] [158238] (1 PDB entry)
    Uniprot Q8WXH5 386-429
  8. 2351834Domain d2izva1: 2izv A:386-429 [145555]
    Other proteins in same PDB: d2izva2, d2izva3, d2izvb_, d2izvc_
    complexed with cl, edo, na

Details for d2izva1

PDB Entry: 2izv (more details), 2.55 Å

PDB Description: crystal structure of socs-4 in complex with elongin-b and elongin-c at 2.55a resolution
PDB Compounds: (A:) suppressor of cytokine signaling 4

SCOPe Domain Sequences for d2izva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2izva1 a.271.1.1 (A:386-429) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]}
pfslqhicrtvicncttydgidalpipssmklylkeyhykskvr

SCOPe Domain Coordinates for d2izva1:

Click to download the PDB-style file with coordinates for d2izva1.
(The format of our PDB-style files is described here.)

Timeline for d2izva1: