SCOPe 2.06: Domain d2iy1c_: 2iy1 C:

Lineage for d2iy1c_ (2iy1 C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.7: Adenain-like [54054] (6 proteins)
   Pfam PF02902; Ulp1 protease family

6. Protein Sentrin-specific protease 1 [142862] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142863] (7 PDB entries)
   Uniprot Q9P0U3 419-643

8. Domain d2iy1c_: 2iy1 C: [145554]
   Other proteins in same PDB: d2iy1b_, d2iy1d_
   automated match to d2iy0a1
   mutant

Details for d2iy1c_

PDB Entry: 2iy1, 2.46 Å

PDB Description: senp1 (mutant) full length sumo1

PDB Compounds: (C:) sentrin-specific protease 1

SCOPe Domain Sequences for d2iy1c_:

Sequence; same for both SEQRES and ATOM records:

>d2iy1c_ d.3.1.7 (C:) Sentrin-specific protease 1 {Human (Homo sapiens) [TaxId: 9606]}
efpeiteemekeiknvfrngnqdevlseafrltitrkdiqtlnhlnwlndeiinfymnml
merskekglpsvhafntffftklktagyqavkrwtkkvdvfsvdillvpihlgvhwclav
vdfrkknityydsmgginneacrillqylkqesidkkrkefdtngwqlfskksqeipqqm
ngsdagmfackyadcitkdrpinftqqhmpyfrkrmvweilhrkll

Timeline for d2iy1c_:

• d2iy1c_ first appeared in SCOP 1.75, called d2iy1c1
  
• d2iy1c_ appears in SCOPe 2.05
  
• d2iy1c_ appears in SCOPe 2.07
  
• d2iy1c_ appears in the current release, SCOPe 2.08