Lineage for d2iy1c_ (2iy1 C:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1191813Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1191814Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1192326Family d.3.1.7: Adenain-like [54054] (6 proteins)
    Pfam PF02902; Ulp1 protease family
  6. 1192332Protein Sentrin-specific protease 1 [142862] (1 species)
  7. 1192333Species Human (Homo sapiens) [TaxId:9606] [142863] (6 PDB entries)
    Uniprot Q9P0U3 419-643
  8. 1192339Domain d2iy1c_: 2iy1 C: [145554]
    Other proteins in same PDB: d2iy1b1, d2iy1d1
    automated match to d2iy0a1
    mutant

Details for d2iy1c_

PDB Entry: 2iy1 (more details), 2.46 Å

PDB Description: senp1 (mutant) full length sumo1
PDB Compounds: (C:) sentrin-specific protease 1

SCOPe Domain Sequences for d2iy1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iy1c_ d.3.1.7 (C:) Sentrin-specific protease 1 {Human (Homo sapiens) [TaxId: 9606]}
efpeiteemekeiknvfrngnqdevlseafrltitrkdiqtlnhlnwlndeiinfymnml
merskekglpsvhafntffftklktagyqavkrwtkkvdvfsvdillvpihlgvhwclav
vdfrkknityydsmgginneacrillqylkqesidkkrkefdtngwqlfskksqeipqqm
ngsdagmfackyadcitkdrpinftqqhmpyfrkrmvweilhrkll

SCOPe Domain Coordinates for d2iy1c_:

Click to download the PDB-style file with coordinates for d2iy1c_.
(The format of our PDB-style files is described here.)

Timeline for d2iy1c_: