Lineage for d2iy1a1 (2iy1 A:419-643)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 851268Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 851269Superfamily d.3.1: Cysteine proteinases [54001] (22 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 851683Family d.3.1.7: Adenain-like [54054] (5 proteins)
    Pfam PF02902; Ulp1 protease family
  6. 851688Protein Sentrin-specific protease 1 [142862] (1 species)
  7. 851689Species Human (Homo sapiens) [TaxId:9606] [142863] (4 PDB entries)
    Uniprot Q9P0U3 419-643
  8. 851690Domain d2iy1a1: 2iy1 A:419-643 [145553]
    Other proteins in same PDB: d2iy1b1, d2iy1d1
    automatically matched to 2IY0 A:419-643
    mutant

Details for d2iy1a1

PDB Entry: 2iy1 (more details), 2.46 Å

PDB Description: senp1 (mutant) full length sumo1
PDB Compounds: (A:) sentrin-specific protease 1

SCOP Domain Sequences for d2iy1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iy1a1 d.3.1.7 (A:419-643) Sentrin-specific protease 1 {Human (Homo sapiens) [TaxId: 9606]}
efpeiteemekeiknvfrngnqdevlseafrltitrkdiqtlnhlnwlndeiinfymnml
merskekglpsvhafntffftklktagyqavkrwtkkvdvfsvdillvpihlgvhwclav
vdfrkknityydsmgginneacrillqylkqesidkkrkefdtngwqlfskksqeipqqm
ngsdagmfackyadcitkdrpinftqqhmpyfrkrmvweilhrkl

SCOP Domain Coordinates for d2iy1a1:

Click to download the PDB-style file with coordinates for d2iy1a1.
(The format of our PDB-style files is described here.)

Timeline for d2iy1a1: