![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.7: Adenain-like [54054] (6 proteins) Pfam PF02902; Ulp1 protease family |
![]() | Protein Sentrin-specific protease 1 [142862] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142863] (8 PDB entries) Uniprot Q9P0U3 419-643 |
![]() | Domain d2iy1a_: 2iy1 A: [145553] Other proteins in same PDB: d2iy1b2, d2iy1b3, d2iy1d2, d2iy1d3 automated match to d2iy0a1 mutant |
PDB Entry: 2iy1 (more details), 2.46 Å
SCOPe Domain Sequences for d2iy1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iy1a_ d.3.1.7 (A:) Sentrin-specific protease 1 {Human (Homo sapiens) [TaxId: 9606]} efpeiteemekeiknvfrngnqdevlseafrltitrkdiqtlnhlnwlndeiinfymnml merskekglpsvhafntffftklktagyqavkrwtkkvdvfsvdillvpihlgvhwclav vdfrkknityydsmgginneacrillqylkqesidkkrkefdtngwqlfskksqeipqqm ngsdagmfackyadcitkdrpinftqqhmpyfrkrmvweilhrkll
Timeline for d2iy1a_: