| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family) ![]() automatically mapped to Pfam PF07834 |
| Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (2 proteins) |
| Protein Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69101] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [158788] (9 PDB entries) Uniprot P46060 431-587! Uniprot P46060 432-587 |
| Domain d2iy0c1: 2iy0 C:432-587 [145552] Other proteins in same PDB: d2iy0a1, d2iy0b_ mutant |
PDB Entry: 2iy0 (more details), 2.77 Å
SCOPe Domain Sequences for d2iy0c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iy0c1 a.118.12.1 (C:432-587) Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
advstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvssvfkdeatvrmavq
davdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlygplmalnhmvqqdyf
pkalaplllafvtkpnsalescsfarhsllqtlykv
Timeline for d2iy0c1: