Lineage for d2iy0c1 (2iy0 C:432-587)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727312Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family) (S)
    automatically mapped to Pfam PF07834
  5. 2727313Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (2 proteins)
  6. 2727314Protein Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69101] (2 species)
  7. 2727315Species Human (Homo sapiens) [TaxId:9606] [158788] (9 PDB entries)
    Uniprot P46060 431-587! Uniprot P46060 432-587
  8. 2727322Domain d2iy0c1: 2iy0 C:432-587 [145552]
    Other proteins in same PDB: d2iy0a1, d2iy0b_
    mutant

Details for d2iy0c1

PDB Entry: 2iy0 (more details), 2.77 Å

PDB Description: senp1 (mutant) sumo1 rangap
PDB Compounds: (C:) ran gtpase-activating protein 1

SCOPe Domain Sequences for d2iy0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iy0c1 a.118.12.1 (C:432-587) Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
advstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvssvfkdeatvrmavq
davdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlygplmalnhmvqqdyf
pkalaplllafvtkpnsalescsfarhsllqtlykv

SCOPe Domain Coordinates for d2iy0c1:

Click to download the PDB-style file with coordinates for d2iy0c1.
(The format of our PDB-style files is described here.)

Timeline for d2iy0c1: