Lineage for d2ixqa1 (2ixq A:2-122)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 789808Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 789904Superfamily b.2.3: Bacterial adhesins [49401] (6 families) (S)
  5. 789909Family b.2.3.2: Pilus subunits [49405] (8 proteins)
  6. 789916Protein Invasin AfaD [158928] (1 species)
  7. 789917Species Escherichia coli [TaxId:562] [158929] (3 PDB entries)
    Uniprot Q47038 27-147
  8. 789920Domain d2ixqa1: 2ixq A:2-122 [145550]
    Other proteins in same PDB: d2ixqb1

Details for d2ixqa1

PDB Entry: 2ixq (more details)

PDB Description: the solution structure of the invasive tip complex from afa-dr fibrils
PDB Compounds: (A:) Protein afaD

SCOP Domain Sequences for d2ixqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ixqa1 b.2.3.2 (A:2-122) Invasin AfaD {Escherichia coli [TaxId: 562]}
aelhlesrggsgtqlrdgakvatgriicreahtgfhvwmnerqvdgraeryvvqskdgrh
elrvrtggdgwspvkgeggkgvsrpgqeeqvffdvmadgnqdiapgeyrfsvggacvvpq
e

SCOP Domain Coordinates for d2ixqa1:

Click to download the PDB-style file with coordinates for d2ixqa1.
(The format of our PDB-style files is described here.)

Timeline for d2ixqa1:

Domains from other chains:
(mouse over for more information)
d2ixqb1