SCOP 1.75: Domain d2ixqa1: 2ixq A:2-122

Lineage for d2ixqa1 (2ixq A:2-122)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (6 families)

5. Family b.2.3.2: Pilus subunits [49405] (8 proteins)

6. Protein Invasin AfaD [158928] (1 species)

7. Species Escherichia coli [TaxId:562] [158929] (3 PDB entries)
   Uniprot Q47038 27-147

8. Domain d2ixqa1: 2ixq A:2-122 [145550]
   Other proteins in same PDB: d2ixqb1

Details for d2ixqa1

PDB Entry: 2ixq

PDB Description: the solution structure of the invasive tip complex from afa-dr fibrils

PDB Compounds: (A:) Protein afaD

SCOP Domain Sequences for d2ixqa1:

Sequence; same for both SEQRES and ATOM records:

>d2ixqa1 b.2.3.2 (A:2-122) Invasin AfaD {Escherichia coli [TaxId: 562]}
aelhlesrggsgtqlrdgakvatgriicreahtgfhvwmnerqvdgraeryvvqskdgrh
elrvrtggdgwspvkgeggkgvsrpgqeeqvffdvmadgnqdiapgeyrfsvggacvvpq
e

Timeline for d2ixqa1:

• d2ixqa1 is new in SCOP 1.75
  
• d2ixqa1 appears in SCOPe 2.01
  
• d2ixqa1 appears in the current release, SCOPe 2.08