Lineage for d2iw9c1 (2iw9 C:1-295)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 874554Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 874564Species Human (Homo sapiens) [TaxId:9606] [88856] (128 PDB entries)
    Uniprot P24941
  8. 874598Domain d2iw9c1: 2iw9 C:1-295 [145547]
    Other proteins in same PDB: d2iw9b1, d2iw9b2, d2iw9d1, d2iw9d2
    automatically matched to 2IW6 A:1-295
    complexed with 4sp, mg, sgm; mutant

Details for d2iw9c1

PDB Entry: 2iw9 (more details), 2 Å

PDB Description: structure of human thr160-phospho cdk2-cyclin a complexed with a bisanilinopyrimidine inhibitor
PDB Compounds: (C:) Cell division protein kinase 2

SCOP Domain Sequences for d2iw9c1:

Sequence, based on SEQRES records: (download)

>d2iw9c1 d.144.1.7 (C:1-295) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh
pnivklldvihtenklylvfeflhqdlktfmdasaltgiplpliksylfqllqglafchs
hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy
stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf
pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvph

Sequence, based on observed residues (ATOM records): (download)

>d2iw9c1 d.144.1.7 (C:1-295) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh
pnivklldvihtenklylvfeflhqdlktfmdasaltgiplpliksylfqllqglafchs
hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy
stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpvvppldedgrsllsqmlh
ydpnkrisakaalahpffqdvtkpvph

SCOP Domain Coordinates for d2iw9c1:

Click to download the PDB-style file with coordinates for d2iw9c1.
(The format of our PDB-style files is described here.)

Timeline for d2iw9c1: