Lineage for d2iw8c2 (2iw8 C:1-296)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2589707Protein automated matches [190091] (20 species)
    not a true protein
  7. 2589831Species Human (Homo sapiens) [TaxId:9606] [188447] (892 PDB entries)
  8. 2590387Domain d2iw8c2: 2iw8 C:1-296 [145545]
    Other proteins in same PDB: d2iw8a1, d2iw8a2, d2iw8b1, d2iw8b2, d2iw8c3, d2iw8d1, d2iw8d2
    automated match to d1ogua_
    complexed with 4sp, sgm; mutant

Details for d2iw8c2

PDB Entry: 2iw8 (more details), 2.3 Å

PDB Description: structure of human thr160-phospho cdk2-cyclin a f82h-l83v-h84d mutant with an o6-cyclohexylmethylguanine inhibitor
PDB Compounds: (C:) Cell division protein kinase 2

SCOPe Domain Sequences for d2iw8c2:

Sequence, based on SEQRES records: (download)

>d2iw8c2 d.144.1.7 (C:1-296) automated matches {Human (Homo sapiens) [TaxId: 9606]}
menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh
pnivklldvihtenklylvfehvdqdlkkfmdasaltgiplpliksylfqllqglafchs
hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy
stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf
pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl

Sequence, based on observed residues (ATOM records): (download)

>d2iw8c2 d.144.1.7 (C:1-296) automated matches {Human (Homo sapiens) [TaxId: 9606]}
menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh
pnivklldvihtenklylvfehvdqdlkkfmdasaltgiplpliksylfqllqglafchs
hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy
stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgvppldedgrsllsqmlhydp
nkrisakaalahpffqdvtkpvphl

SCOPe Domain Coordinates for d2iw8c2:

Click to download the PDB-style file with coordinates for d2iw8c2.
(The format of our PDB-style files is described here.)

Timeline for d2iw8c2: