Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (20 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188447] (892 PDB entries) |
Domain d2iw8c2: 2iw8 C:1-296 [145545] Other proteins in same PDB: d2iw8a1, d2iw8a2, d2iw8b1, d2iw8b2, d2iw8c3, d2iw8d1, d2iw8d2 automated match to d1ogua_ complexed with 4sp, sgm; mutant |
PDB Entry: 2iw8 (more details), 2.3 Å
SCOPe Domain Sequences for d2iw8c2:
Sequence, based on SEQRES records: (download)
>d2iw8c2 d.144.1.7 (C:1-296) automated matches {Human (Homo sapiens) [TaxId: 9606]} menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh pnivklldvihtenklylvfehvdqdlkkfmdasaltgiplpliksylfqllqglafchs hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
>d2iw8c2 d.144.1.7 (C:1-296) automated matches {Human (Homo sapiens) [TaxId: 9606]} menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh pnivklldvihtenklylvfehvdqdlkkfmdasaltgiplpliksylfqllqglafchs hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgvppldedgrsllsqmlhydp nkrisakaalahpffqdvtkpvphl
Timeline for d2iw8c2: