SCOPe 2.02: Domain d2iw8c_: 2iw8 C:

Lineage for d2iw8c_ (2iw8 C:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (293 PDB entries)

8. Domain d2iw8c_: 2iw8 C: [145545]
   Other proteins in same PDB: d2iw8a1, d2iw8b1, d2iw8b2, d2iw8d1, d2iw8d2
   automated match to d1ogua_
   complexed with 4sp, sgm; mutant

Details for d2iw8c_

PDB Entry: 2iw8, 2.3 Å

PDB Description: structure of human thr160-phospho cdk2-cyclin a f82h-l83v-h84d mutant with an o6-cyclohexylmethylguanine inhibitor

PDB Compounds: (C:) Cell division protein kinase 2

SCOPe Domain Sequences for d2iw8c_:

Sequence, based on SEQRES records:

>d2iw8c_ d.144.1.7 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfehvdqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl

Sequence, based on observed residues (ATOM records):

>d2iw8c_ d.144.1.7 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfehvdqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgvppldedgrsllsqmlhyd
pnkrisakaalahpffqdvtkpvphl

Timeline for d2iw8c_:

• d2iw8c_ first appeared in SCOP 1.75, called d2iw8c1
  
• d2iw8c_ appears in SCOPe 2.01
  
• d2iw8c_ appears in SCOPe 2.03
  
• d2iw8c_ appears in the current release, SCOPe 2.08, called d2iw8c2