SCOP 1.75: Domain d2iw8c1: 2iw8 C:1-296

Lineage for d2iw8c1 (2iw8 C:1-296)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [88856] (128 PDB entries)
   Uniprot P24941

8. Domain d2iw8c1: 2iw8 C:1-296 [145545]
   Other proteins in same PDB: d2iw8b1, d2iw8b2, d2iw8d1, d2iw8d2
   automatically matched to 2IW8 A:1-297
   complexed with 4sp, sgm; mutant

Details for d2iw8c1

PDB Entry: 2iw8, 2.3 Å

PDB Description: structure of human thr160-phospho cdk2-cyclin a f82h-l83v-h84d mutant with an o6-cyclohexylmethylguanine inhibitor

PDB Compounds: (C:) Cell division protein kinase 2

SCOP Domain Sequences for d2iw8c1:

Sequence, based on SEQRES records:

>d2iw8c1 d.144.1.7 (C:1-296) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh
pnivklldvihtenklylvfehvdqdlkkfmdasaltgiplpliksylfqllqglafchs
hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy
stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf
pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl

Sequence, based on observed residues (ATOM records):

>d2iw8c1 d.144.1.7 (C:1-296) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh
pnivklldvihtenklylvfehvdqdlkkfmdasaltgiplpliksylfqllqglafchs
hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy
stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgvppldedgrsllsqmlhydp
nkrisakaalahpffqdvtkpvphl

Timeline for d2iw8c1:

• d2iw8c1 is new in SCOP 1.75
  
• d2iw8c1 is called d2iw8c_ in SCOPe 2.01
  
• d2iw8c1 appears in the current release, SCOPe 2.08, called d2iw8c2