Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Cyclin-dependent PK, CDK2 [88855] (2 species) CMGC group; CDKs subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [88856] (340 PDB entries) Uniprot P24941 |
Domain d2iw8a1: 2iw8 A:1-297 [145544] Other proteins in same PDB: d2iw8b1, d2iw8b2, d2iw8c_, d2iw8d1, d2iw8d2 complexed with 4sp, sgm; mutant |
PDB Entry: 2iw8 (more details), 2.3 Å
SCOPe Domain Sequences for d2iw8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iw8a1 d.144.1.7 (A:1-297) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh pnivklldvihtenklylvfehvdqdlkkfmdasaltgiplpliksylfqllqglafchs hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr
Timeline for d2iw8a1: