Lineage for d2iw8a1 (2iw8 A:1-297)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1220363Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 1220364Species Human (Homo sapiens) [TaxId:9606] [88856] (223 PDB entries)
    Uniprot P24941
  8. 1220540Domain d2iw8a1: 2iw8 A:1-297 [145544]
    Other proteins in same PDB: d2iw8b1, d2iw8b2, d2iw8c_, d2iw8d1, d2iw8d2
    complexed with 4sp, sgm; mutant

Details for d2iw8a1

PDB Entry: 2iw8 (more details), 2.3 Å

PDB Description: structure of human thr160-phospho cdk2-cyclin a f82h-l83v-h84d mutant with an o6-cyclohexylmethylguanine inhibitor
PDB Compounds: (A:) Cell division protein kinase 2

SCOPe Domain Sequences for d2iw8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iw8a1 d.144.1.7 (A:1-297) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh
pnivklldvihtenklylvfehvdqdlkkfmdasaltgiplpliksylfqllqglafchs
hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy
stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf
pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

SCOPe Domain Coordinates for d2iw8a1:

Click to download the PDB-style file with coordinates for d2iw8a1.
(The format of our PDB-style files is described here.)

Timeline for d2iw8a1: