SCOPe 2.07: Domain d2iw6c2: 2iw6 C:1-295

Lineage for d2iw6c2 (2iw6 C:1-295)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [88856] (413 PDB entries)
   Uniprot P24941

8. Domain d2iw6c2: 2iw6 C:1-295 [145543]
   Other proteins in same PDB: d2iw6a2, d2iw6b1, d2iw6b2, d2iw6c3, d2iw6d1, d2iw6d2
   automated match to d1ogua_
   complexed with mg, qq2, sgm

Details for d2iw6c2

PDB Entry: 2iw6, 2.3 Å

PDB Description: structure of human thr160-phospho cdk2-cyclin a complexed with a bisanilinopyrimidine inhibitor

PDB Compounds: (C:) Cell division protein kinase 2

SCOPe Domain Sequences for d2iw6c2:

Sequence; same for both SEQRES and ATOM records:

>d2iw6c2 d.144.1.7 (C:1-295) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh
pnivklldvihtenklylvfeflhqdlktfmdasaltgiplpliksylfqllqglafchs
hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy
stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf
pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvph

Timeline for d2iw6c2:

• d2iw6c2 first appeared in SCOP 1.75, called d2iw6c1
  
• d2iw6c2 appears in SCOPe 2.06
  
• d2iw6c2 appears in the current release, SCOPe 2.08