![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
![]() | Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) ![]() N-terminal domain is beta/beta/alpha common fold |
![]() | Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins) |
![]() | Protein Lysine-specific histone demethylase 1, LSD1 [159953] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [159954] (27 PDB entries) Uniprot O60341 655-763 |
![]() | Domain d2iw5a3: 2iw5 A:655-763 [145541] Other proteins in same PDB: d2iw5a1, d2iw5a2, d2iw5b1, d2iw5b2 complexed with cl, fad, gol, nh4 |
PDB Entry: 2iw5 (more details), 2.57 Å
SCOPe Domain Sequences for d2iw5a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iw5a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} gfgnlnkvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlykapillalvageaagi menisddvivgrclailkgifgssavpqpketvvsrwradpwargsysy
Timeline for d2iw5a3: