Lineage for d2iw5a2 (2iw5 A:274-654,A:764-836)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1154265Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1154266Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 1154320Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 1154402Protein Lysine-specific histone demethylase 1, LSD1 [159432] (1 species)
  7. 1154403Species Human (Homo sapiens) [TaxId:9606] [159433] (8 PDB entries)
    Uniprot O60341 274-654,764-836
  8. 1154407Domain d2iw5a2: 2iw5 A:274-654,A:764-836 [145540]
    Other proteins in same PDB: d2iw5a1, d2iw5a3, d2iw5b1
    includes the CoREST-binding subdomain (420-520), a long alpha-helical hairpin
    complexed with cl, fad, gol, nh4

Details for d2iw5a2

PDB Entry: 2iw5 (more details), 2.57 Å

PDB Description: structural basis for corest-dependent demethylation of nucleosomes by the human lsd1 histone demethylase
PDB Compounds: (A:) Lysine-specific histone demethylase 1

SCOPe Domain Sequences for d2iw5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iw5a2 c.3.1.2 (A:274-654,A:764-836) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
ptkktgkviiigsgvsglaaarqlqsfgmdvtlleardrvggrvatfrkgnyvadlgamv
vtglggnpmavvskqvnmelakikqkcplyeangqavpkekdemveqefnrlleatsyls
hqldfnvlnnkpvslgqalevviqlqekhvkdeqiehwkkivktqeelkellnkmvnlke
kikelhqqykeasevkpprditaeflvkskhrdltalckeydelaetqgkleeklqelea
nppsdvylssrdrqildwhfanlefanatplstlslkhwdqdddfeftgshltvrngysc
vpvalaegldiklntavrqvrytasgceviavntrstsqtfiykcdavlctlplgvlkqq
ppavqfvpplpewktsavqrmXvaagssgndydlmaqpitpgpsipgapqpiprlffage
htirnypatvhgallsglreagriadqflgamytl

SCOPe Domain Coordinates for d2iw5a2:

Click to download the PDB-style file with coordinates for d2iw5a2.
(The format of our PDB-style files is described here.)

Timeline for d2iw5a2:

View in 3D
Domains from other chains:
(mouse over for more information)
d2iw5b1