Lineage for d2iw5a1 (2iw5 A:171-273)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 905282Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 905965Family a.4.1.18: SWIRM domain [140222] (3 proteins)
    Pfam PF04433; contains extra N-terminal helix
  6. 905966Protein Lysine-specific histone demethylase 1, LSD1 [140227] (1 species)
  7. 905967Species Human (Homo sapiens) [TaxId:9606] [140228] (9 PDB entries)
    Uniprot O60341 169-279
  8. 905971Domain d2iw5a1: 2iw5 A:171-273 [145539]
    Other proteins in same PDB: d2iw5a2, d2iw5a3, d2iw5b1
    complexed with cl, fad, gol, nh4

Details for d2iw5a1

PDB Entry: 2iw5 (more details), 2.57 Å

PDB Description: structural basis for corest-dependent demethylation of nucleosomes by the human lsd1 histone demethylase
PDB Compounds: (A:) Lysine-specific histone demethylase 1

SCOPe Domain Sequences for d2iw5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iw5a1 a.4.1.18 (A:171-273) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
psgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqlt
featlqqleapynsdtvlvhrvhsylerhglinfgiykrikpl

SCOPe Domain Coordinates for d2iw5a1:

Click to download the PDB-style file with coordinates for d2iw5a1.
(The format of our PDB-style files is described here.)

Timeline for d2iw5a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2iw5b1