SCOP 1.75: Domain d2iw5a1: 2iw5 A:171-273

Lineage for d2iw5a1 (2iw5 A:171-273)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (19 families)
   consists only of helices

5. Family a.4.1.18: SWIRM domain [140222] (3 proteins)
   Pfam PF04433; contains extra N-terminal helix

6. Protein Lysine-specific histone demethylase 1, LSD1 [140227] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140228] (9 PDB entries)
   Uniprot O60341 169-279

8. Domain d2iw5a1: 2iw5 A:171-273 [145539]
   Other proteins in same PDB: d2iw5a2, d2iw5a3, d2iw5b1
   complexed with cl, fad, gol, nh4

Details for d2iw5a1

PDB Entry: 2iw5, 2.57 Å

PDB Description: structural basis for corest-dependent demethylation of nucleosomes by the human lsd1 histone demethylase

PDB Compounds: (A:) Lysine-specific histone demethylase 1

SCOP Domain Sequences for d2iw5a1:

Sequence; same for both SEQRES and ATOM records:

>d2iw5a1 a.4.1.18 (A:171-273) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
psgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqlt
featlqqleapynsdtvlvhrvhsylerhglinfgiykrikpl

Timeline for d2iw5a1:

• d2iw5a1 is new in SCOP 1.75
  
• d2iw5a1 appears in SCOPe 2.01
  
• d2iw5a1 appears in the current release, SCOPe 2.08