Lineage for d2io3c1 (2io3 C:432-587)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727312Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family) (S)
    automatically mapped to Pfam PF07834
  5. 2727313Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (2 proteins)
  6. 2727314Protein Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69101] (2 species)
  7. 2727315Species Human (Homo sapiens) [TaxId:9606] [158788] (9 PDB entries)
    Uniprot P46060 431-587! Uniprot P46060 432-587
  8. 2727324Domain d2io3c1: 2io3 C:432-587 [145537]
    Other proteins in same PDB: d2io3a1, d2io3b1
    automatically matched to 2IO2 C:432-587

Details for d2io3c1

PDB Entry: 2io3 (more details), 3.2 Å

PDB Description: crystal structure of human senp2 in complex with rangap1-sumo-2
PDB Compounds: (C:) ran gtpase-activating protein 1

SCOPe Domain Sequences for d2io3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2io3c1 a.118.12.1 (C:432-587) Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
advstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvssvfkdeatvrmavq
davdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlygplmalnhmvqqdyf
pkalaplllafvtkpnsalesssfarhsllqtlykv

SCOPe Domain Coordinates for d2io3c1:

Click to download the PDB-style file with coordinates for d2io3c1.
(The format of our PDB-style files is described here.)

Timeline for d2io3c1: