Lineage for d2io3a1 (2io3 A:366-589)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1191813Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1191814Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1192326Family d.3.1.7: Adenain-like [54054] (6 proteins)
    Pfam PF02902; Ulp1 protease family
  6. 1192344Protein Sentrin-specific protease 2, SENP2 [110771] (1 species)
  7. 1192345Species Human (Homo sapiens) [TaxId:9606] [110772] (6 PDB entries)
    Uniprot Q9HC62 366-589
  8. 1192354Domain d2io3a1: 2io3 A:366-589 [145536]
    Other proteins in same PDB: d2io3b1, d2io3c1
    automatically matched to 2IO0 A:364-589

Details for d2io3a1

PDB Entry: 2io3 (more details), 3.2 Å

PDB Description: crystal structure of human senp2 in complex with rangap1-sumo-2
PDB Compounds: (A:) Sentrin-specific protease 2

SCOPe Domain Sequences for d2io3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2io3a1 d.3.1.7 (A:366-589) Sentrin-specific protease 2, SENP2 {Human (Homo sapiens) [TaxId: 9606]}
leltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllve
rnkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvid
lrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlng
sdsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll

SCOPe Domain Coordinates for d2io3a1:

Click to download the PDB-style file with coordinates for d2io3a1.
(The format of our PDB-style files is described here.)

Timeline for d2io3a1: