SCOPe 2.08: Domain d2io3a1: 2io3 A:366-589

Lineage for d2io3a1 (2io3 A:366-589)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.7: Adenain-like [54054] (6 proteins)
   Pfam PF02902; Ulp1 protease family

6. Protein Sentrin-specific protease 2, SENP2 [110771] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110772] (7 PDB entries)
   Uniprot Q9HC62 366-589

8. Domain d2io3a1: 2io3 A:366-589 [145536]
   Other proteins in same PDB: d2io3b1, d2io3c1
   automatically matched to 2IO0 A:364-589

Details for d2io3a1

PDB Entry: 2io3, 3.2 Å

PDB Description: crystal structure of human senp2 in complex with rangap1-sumo-2

PDB Compounds: (A:) Sentrin-specific protease 2

SCOPe Domain Sequences for d2io3a1:

Sequence; same for both SEQRES and ATOM records:

>d2io3a1 d.3.1.7 (A:366-589) Sentrin-specific protease 2, SENP2 {Human (Homo sapiens) [TaxId: 9606]}
leltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllve
rnkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvid
lrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlng
sdsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll

Timeline for d2io3a1:

• d2io3a1 first appeared in SCOP 1.75
  
• d2io3a1 appears in SCOPe 2.07