![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.7: Adenain-like [54054] (6 proteins) Pfam PF02902; Ulp1 protease family |
![]() | Protein Sentrin-specific protease 2, SENP2 [110771] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [110772] (7 PDB entries) Uniprot Q9HC62 366-589 |
![]() | Domain d2io1e_: 2io1 E: [145533] Other proteins in same PDB: d2io1b_, d2io1d_, d2io1f_ automated match to d2io0a1 |
PDB Entry: 2io1 (more details), 2.6 Å
SCOPe Domain Sequences for d2io1e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2io1e_ d.3.1.7 (E:) Sentrin-specific protease 2, SENP2 {Human (Homo sapiens) [TaxId: 9606]} eltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllver nkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvidl rkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlngs dsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
Timeline for d2io1e_: