SCOP 1.75: Domain d2io1e1: 2io1 E:367-589

Lineage for d2io1e1 (2io1 E:367-589)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (22 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.7: Adenain-like [54054] (5 proteins)
   Pfam PF02902; Ulp1 protease family

6. Protein Sentrin-specific protease 2, SENP2 [110771] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110772] (6 PDB entries)
   Uniprot Q9HC62 366-589

8. Domain d2io1e1: 2io1 E:367-589 [145533]
   Other proteins in same PDB: d2io1b1, d2io1d1, d2io1f1
   automatically matched to 2IO0 A:364-589
   mutant

Details for d2io1e1

PDB Entry: 2io1, 2.6 Å

PDB Description: crystal structure of human senp2 in complex with presumo-3

PDB Compounds: (E:) Sentrin-specific protease 2

SCOP Domain Sequences for d2io1e1:

Sequence; same for both SEQRES and ATOM records:

>d2io1e1 d.3.1.7 (E:367-589) Sentrin-specific protease 2, SENP2 {Human (Homo sapiens) [TaxId: 9606]}
eltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllver
nkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvidl
rkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlngs
dsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll

Timeline for d2io1e1:

• d2io1e1 is new in SCOP 1.75
  
• d2io1e1 is called d2io1e_ in SCOPe 2.01
  
• d2io1e1 appears in the current release, SCOPe 2.08, called d2io1e_