Lineage for d2ik8d_ (2ik8 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719790Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2719791Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2719792Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)
  6. 2719817Protein Regulator of G-protein signaling 16, RGS16 [158689] (2 species)
  7. 2719818Species Human (Homo sapiens) [TaxId:9606] [158690] (1 PDB entry)
    Uniprot O15492 65-184
  8. 2719820Domain d2ik8d_: 2ik8 D: [145529]
    Other proteins in same PDB: d2ik8a1, d2ik8a2, d2ik8c1, d2ik8c2
    automated match to d2ik8b1
    complexed with alf, gdp, mg, so4

Details for d2ik8d_

PDB Entry: 2ik8 (more details), 2.71 Å

PDB Description: Crystal structure of the heterodimeric complex of human RGS16 and activated Gi alpha 1
PDB Compounds: (D:) Regulator of G-protein signaling 16

SCOPe Domain Sequences for d2ik8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ik8d_ a.91.1.1 (D:) Regulator of G-protein signaling 16, RGS16 {Human (Homo sapiens) [TaxId: 9606]}
fsedvlgwresfdlllsskngvaafhaflktefseenlefwlaceefkkirsatklasra
hqifeeficseapkevnidhetreltrmnlqtatatcfdaaqgktrtlmekdsyprflks
payrdlaaqa

SCOPe Domain Coordinates for d2ik8d_:

Click to download the PDB-style file with coordinates for d2ik8d_.
(The format of our PDB-style files is described here.)

Timeline for d2ik8d_: