| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) ![]() |
| Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins) |
| Protein Regulator of G-protein signaling 16, RGS16 [158689] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [158690] (1 PDB entry) Uniprot O15492 65-184 |
| Domain d2ik8b1: 2ik8 B:65-180 [145528] Other proteins in same PDB: d2ik8a1, d2ik8a2, d2ik8c1, d2ik8c2 complexed with alf, gdp, mg, so4 |
PDB Entry: 2ik8 (more details), 2.71 Å
SCOPe Domain Sequences for d2ik8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ik8b1 a.91.1.1 (B:65-180) Regulator of G-protein signaling 16, RGS16 {Human (Homo sapiens) [TaxId: 9606]}
sfdlllsskngvaafhaflktefseenlefwlaceefkkirsatklasrahqifeefics
eapkevnidhetreltrmnlqtatatcfdaaqgktrtlmekdsyprflkspayrdl
Timeline for d2ik8b1: