SCOPe 2.05: Domain d2ik8b1: 2ik8 B:65-180

Lineage for d2ik8b1 (2ik8 B:65-180)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)

6. Protein Regulator of G-protein signaling 16, RGS16 [158689] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158690] (1 PDB entry)
   Uniprot O15492 65-184

8. Domain d2ik8b1: 2ik8 B:65-180 [145528]
   Other proteins in same PDB: d2ik8a1, d2ik8a2, d2ik8c1, d2ik8c2
   complexed with alf, gdp, mg, so4

Details for d2ik8b1

PDB Entry: 2ik8, 2.71 Å

PDB Description: Crystal structure of the heterodimeric complex of human RGS16 and activated Gi alpha 1

PDB Compounds: (B:) Regulator of G-protein signaling 16

SCOPe Domain Sequences for d2ik8b1:

Sequence; same for both SEQRES and ATOM records:

>d2ik8b1 a.91.1.1 (B:65-180) Regulator of G-protein signaling 16, RGS16 {Human (Homo sapiens) [TaxId: 9606]}
sfdlllsskngvaafhaflktefseenlefwlaceefkkirsatklasrahqifeefics
eapkevnidhetreltrmnlqtatatcfdaaqgktrtlmekdsyprflkspayrdl

Timeline for d2ik8b1:

• d2ik8b1 first appeared in SCOP 1.75
  
• d2ik8b1 appears in SCOPe 2.04
  
• d2ik8b1 appears in SCOPe 2.06
  
• d2ik8b1 appears in the current release, SCOPe 2.08