Lineage for d2ijob1 (2ijo B:5-176)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797067Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 2797068Protein NS3 protease [50600] (5 species)
  7. 2797106Species West Nile virus [TaxId:11082] [141386] (2 PDB entries)
    Uniprot P06935 1520-1671
  8. 2797108Domain d2ijob1: 2ijo B:5-176 [145527]
    Other proteins in same PDB: d2ijoa_, d2ijoi_
    complexed with NS2B cofactor, chain A

Details for d2ijob1

PDB Entry: 2ijo (more details), 2.3 Å

PDB Description: crystal structure of the west nile virus ns2b-ns3 protease complexed with bovine pancreatic trypsin inhibitor
PDB Compounds: (B:) Polyprotein

SCOPe Domain Sequences for d2ijob1:

Sequence, based on SEQRES records: (download)

>d2ijob1 b.47.1.3 (B:5-176) NS3 protease {West Nile virus [TaxId: 11082]}
wdtpspkeykkgdtttgvyrimtrgllgsyqagagvmvegvfhtlwhttkgaalmsgegr
ldpywgsvkedrlcyggpwqlqhkwngqdevqmivvepgrnvknvqtkpgvfktpegeig
avtldfptgtsgspivdkngdviglygngvimpngsyisaivqgermdepip

Sequence, based on observed residues (ATOM records): (download)

>d2ijob1 b.47.1.3 (B:5-176) NS3 protease {West Nile virus [TaxId: 11082]}
wkkgdtttgvyrimtrgllgsyqagagvmvegvfhtlwhttkgaalmsgegrldpywgsv
kedrlcyggpwqlqhkwngqdevqmivvepgrnvknvqtkpgvfktpegeigavtldfpt
gtsgspivdkngdviglygngvimpngsyisaivqgermdepip

SCOPe Domain Coordinates for d2ijob1:

Click to download the PDB-style file with coordinates for d2ijob1.
(The format of our PDB-style files is described here.)

Timeline for d2ijob1: