Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.3: Viral proteases [50596] (5 proteins) beta sheet in the first domain is opened rather than forms a barrel |
Protein NS3 protease [50600] (5 species) |
Species West Nile virus [TaxId:11082] [141386] (2 PDB entries) Uniprot P06935 1520-1671 |
Domain d2ijob1: 2ijo B:5-176 [145527] Other proteins in same PDB: d2ijoa_, d2ijoi_ complexed with NS2B cofactor, chain A |
PDB Entry: 2ijo (more details), 2.3 Å
SCOPe Domain Sequences for d2ijob1:
Sequence, based on SEQRES records: (download)
>d2ijob1 b.47.1.3 (B:5-176) NS3 protease {West Nile virus [TaxId: 11082]} wdtpspkeykkgdtttgvyrimtrgllgsyqagagvmvegvfhtlwhttkgaalmsgegr ldpywgsvkedrlcyggpwqlqhkwngqdevqmivvepgrnvknvqtkpgvfktpegeig avtldfptgtsgspivdkngdviglygngvimpngsyisaivqgermdepip
>d2ijob1 b.47.1.3 (B:5-176) NS3 protease {West Nile virus [TaxId: 11082]} wkkgdtttgvyrimtrgllgsyqagagvmvegvfhtlwhttkgaalmsgegrldpywgsv kedrlcyggpwqlqhkwngqdevqmivvepgrnvknvqtkpgvfktpegeigavtldfpt gtsgspivdkngdviglygngvimpngsyisaivqgermdepip
Timeline for d2ijob1: