Lineage for d2ij0e1 (2ij0 E:1-117)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 783727Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 783750Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries)
  8. 783776Domain d2ij0e1: 2ij0 E:1-117 [145526]
    Other proteins in same PDB: d2ij0a1, d2ij0a2, d2ij0b1, d2ij0b2
    automatically matched to 2IJ0 C:1-117

Details for d2ij0e1

PDB Entry: 2ij0 (more details), 2.25 Å

PDB Description: Structural basis of T cell specificity and activation by the bacterial superantigen toxic shock syndrome toxin-1
PDB Compounds: (E:) penultimate affinity-matured variant of hVbeta 2.1, D10

SCOP Domain Sequences for d2ij0e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ij0e1 b.1.1.1 (E:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gavvsqhpsmvivksgtsvkiecrsldtnihtmfwyrqfpkqslmlmatshqgfnaiyeq
gvvkdkflinhasptlstltvtsahpedsgfyvcsalagsgsstdtqyfgpgtqltvl

SCOP Domain Coordinates for d2ij0e1:

Click to download the PDB-style file with coordinates for d2ij0e1.
(The format of our PDB-style files is described here.)

Timeline for d2ij0e1: