Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins) |
Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries) |
Domain d2ij0c1: 2ij0 C:1-117 [145525] Other proteins in same PDB: d2ij0a1, d2ij0a2, d2ij0b1, d2ij0b2 |
PDB Entry: 2ij0 (more details), 2.25 Å
SCOP Domain Sequences for d2ij0c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} gavvsqhpsmvivksgtsvkiecrsldtnihtmfwyrqfpkqslmlmatshqgfnaiyeq gvvkdkflinhasptlstltvtsahpedsgfyvcsalagsgsstdtqyfgpgtqltvl
Timeline for d2ij0c1: