Lineage for d2ie3c1 (2ie3 C:6-293)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2603960Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2603961Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2604064Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 2604070Protein Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha [143933] (1 species)
  7. 2604071Species Human (Homo sapiens) [TaxId:9606] [143934] (12 PDB entries)
    Uniprot P67775 2-294
  8. 2604072Domain d2ie3c1: 2ie3 C:6-293 [145523]
    Other proteins in same PDB: d2ie3a_
    complexed with mn

Details for d2ie3c1

PDB Entry: 2ie3 (more details), 2.8 Å

PDB Description: Structure of the Protein Phosphatase 2A Core Enzyme Bound to Tumor-inducing Toxins
PDB Compounds: (C:) Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform

SCOPe Domain Sequences for d2ie3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ie3c1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]}
ftkeldqwieqlneckqlsesqvkslcekakeiltkesnvqevrcpvtvcgdvhgqfhdl
melfriggkspdtnylfmgdyvdrgyysvetvtllvalkvryreritilrgnhesrqitq
vygfydeclrkygnanvwkyftdlfdylpltalvdgqifclhgglspsidtldhiraldr
lqevphegpmcdllwsdpddrggwgisprgagytfgqdisetfnhangltlvsrahqlvm
egynwchdrnvvtifsapnycyrcgnqaaimelddtlkysflqfdpap

SCOPe Domain Coordinates for d2ie3c1:

Click to download the PDB-style file with coordinates for d2ie3c1.
(The format of our PDB-style files is described here.)

Timeline for d2ie3c1: