SCOPe 2.08: Domain d2icwl2: 2icw L:3-110

Lineage for d2icwl2 (2icw L:3-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d2icwl2: 2icw L:3-110 [145522]
   Other proteins in same PDB: d2icwa1, d2icwa2, d2icwb1, d2icwb2, d2icwd1, d2icwd2, d2icwe1, d2icwe2, d2icwg_, d2icwh_, d2icwj1, d2icwj2, d2icwl3
   automated match to d2icwj1

Details for d2icwl2

PDB Entry: 2icw, 2.41 Å

PDB Description: crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule

PDB Compounds: (L:) T-cell receptor beta chain V

SCOPe Domain Sequences for d2icwl2:

Sequence; same for both SEQRES and ATOM records:

>d2icwl2 b.1.1.1 (L:3-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrlihysygagstekgdipd
gykasrpsqenfslilesatpsqtsvyfcasggggtlyfgagtrlsvl

Timeline for d2icwl2:

• d2icwl2 first appeared in SCOP 1.75, called d2icwl1
  
• d2icwl2 appears in SCOPe 2.07