SCOPe 2.06: Domain d2icwj1: 2icw J:1-110

Lineage for d2icwj1 (2icw J:1-110)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (28 PDB entries)

8. Domain d2icwj1: 2icw J:1-110 [145521]
   Other proteins in same PDB: d2icwa1, d2icwa2, d2icwb1, d2icwb2, d2icwd1, d2icwd2, d2icwe1, d2icwe2, d2icwg_, d2icwh_, d2icwj2, d2icwl2, d2icwl3

Details for d2icwj1

PDB Entry: 2icw, 2.41 Å

PDB Description: crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule

PDB Compounds: (J:) T-cell receptor beta chain V

SCOPe Domain Sequences for d2icwj1:

Sequence; same for both SEQRES and ATOM records:

>d2icwj1 b.1.1.1 (J:1-110) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
eaavtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrlihysygagstekgdi
pdgykasrpsqenfslilesatpsqtsvyfcasggggtlyfgagtrlsvl

Timeline for d2icwj1:

• d2icwj1 first appeared in SCOP 1.75
  
• d2icwj1 appears in SCOPe 2.05
  
• d2icwj1 appears in SCOPe 2.07
  
• d2icwj1 appears in the current release, SCOPe 2.08