Lineage for d2ibia1 (2ibi A:263-600)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155259Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 protein domains)
    Pfam PF00443
  6. 2155266Protein Ubiquitin carboxyl-terminal hydrolase 2, USP2 [159841] (1 species)
  7. 2155267Species Human (Homo sapiens) [TaxId:9606] [159842] (2 PDB entries)
    Uniprot O75604 263-600! Uniprot O75604 264-599
  8. 2155269Domain d2ibia1: 2ibi A:263-600 [145520]
    Other proteins in same PDB: d2ibib_
    complexed with neh, zn

Details for d2ibia1

PDB Entry: 2ibi (more details), 2.2 Å

PDB Description: Covalent Ubiquitin-USP2 Complex
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 2

SCOPe Domain Sequences for d2ibia1:

Sequence, based on SEQRES records: (download)

>d2ibia1 d.3.1.9 (A:263-600) Ubiquitin carboxyl-terminal hydrolase 2, USP2 {Human (Homo sapiens) [TaxId: 9606]}
aqglaglrnlgntcfmnsilqclsntrelrdyclqrlymrdlhhgsnahtalveefakli
qtiwtsspndvvspsefktqiqryaprfvgynqqdaqeflrflldglhnevnrvtlrpks
npenldhlpddekgrqmwrkyleredsrigdlfvgqlkssltctdcgycstvfdpfwdls
lpiakrgypevtlmdcmrlftkedvldgdaaptccrcrgrkrcikkfsiqrfpkilvlhl
krfsesrirtsklttfvnfplrdldlrefasentnhavynlyavsnhsgttmgghytayc
rspgtgewhtfndssvtpmsssqvrtsdayllfyelas

Sequence, based on observed residues (ATOM records): (download)

>d2ibia1 d.3.1.9 (A:263-600) Ubiquitin carboxyl-terminal hydrolase 2, USP2 {Human (Homo sapiens) [TaxId: 9606]}
aqglaglrnlgntcfmnsilqclsntrelrdyclqrlymrdlhhgsnahtalveefakli
qtiwtsspndvvspsefktqiqryaprfvgynqqdaqeflrflldglhnevnrvtlrpkn
penldhlpddekgrqmwrkyleredsrigdlfvgqlkssltctdcgycstvfdpfwdlsl
piakrgpevtlmdcmrlftkedvldgdaaptccrcrgrkrcikkfsiqrfpkilvlhlkr
fsesrirtsklttfvnfplrdldlrefasenthavynlyavsnhsgttmgghytaycrsp
gtgewhtfndssvtpmsssqvrtsdayllfyelas

SCOPe Domain Coordinates for d2ibia1:

Click to download the PDB-style file with coordinates for d2ibia1.
(The format of our PDB-style files is described here.)

Timeline for d2ibia1: