Lineage for d2i9bf2 (2i9b F:1-86)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 890226Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 890227Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 890414Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 890462Protein Urokinase plasminogen activator surface receptor uPAR [161128] (1 species)
    duplication: tandem repeat of three similar domains; the N-terminal and C-terminal domains belong to Pfam PF00021; uPAR/Ly6
  7. 890463Species Human (Homo sapiens) [TaxId:9606] [161129] (1 PDB entry)
    Uniprot Q03405 109-209! Uniprot Q03405 210-299! Uniprot Q03405 23-108
  8. 890468Domain d2i9bf2: 2i9b F:1-86 [145512]
    Other proteins in same PDB: d2i9ba1, d2i9ba2, d2i9bb1, d2i9bb2, d2i9bc1, d2i9bc2, d2i9bd1, d2i9bd2
    automatically matched to 2I9B E:1-86
    complexed with bma, nag, so4; mutant

Details for d2i9bf2

PDB Entry: 2i9b (more details), 2.8 Å

PDB Description: crystal structure of atf-urokinase receptor complex
PDB Compounds: (F:) Urokinase plasminogen activator surface receptor

SCOP Domain Sequences for d2i9bf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i9bf2 g.7.1.3 (F:1-86) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]}
lrcmqcktngdcrveecalgqdlcrttivrlweegeelelvekscthsektnrtlsyrtg
lkitsltevvcgldlcnqgnsgravt

SCOP Domain Coordinates for d2i9bf2:

Click to download the PDB-style file with coordinates for d2i9bf2.
(The format of our PDB-style files is described here.)

Timeline for d2i9bf2: