Lineage for d2i2vg2 (2i2v G:82-176)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 873695Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 873696Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 873697Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 873698Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 873804Species Escherichia coli [TaxId:562] [160796] (27 PDB entries)
    Uniprot P02390 1-81! Uniprot P02390 82-176
  8. 873812Domain d2i2vg2: 2i2v G:82-176 [145489]
    Other proteins in same PDB: d2i2v01, d2i2v11, d2i2v21, d2i2v31, d2i2v41, d2i2vc1, d2i2vc2, d2i2vd1, d2i2ve1, d2i2vf1, d2i2vh1, d2i2vh2, d2i2vi1, d2i2vi2, d2i2vj1, d2i2vk1, d2i2vl1, d2i2vm1, d2i2vn1, d2i2vo1, d2i2vp1, d2i2vq1, d2i2vr1, d2i2vs1, d2i2vt1, d2i2vu1, d2i2vv1, d2i2vw1, d2i2vx1, d2i2vy1, d2i2vz1
    automatically matched to 2AW4 G:82-176
    complexed with mg, zn

Details for d2i2vg2

PDB Entry: 2i2v (more details), 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (G:) 50S ribosomal protein L6

SCOP Domain Sequences for d2i2vg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i2vg2 d.141.1.1 (G:82-176) Ribosomal protein L6 {Escherichia coli [TaxId: 562]}
ftkklqlvgvgyraavkgnvinlslgfshpvdhqlpagitaecptqteivlkgadkqvig
qvaadlrayrrpepykgkgvryadevvrtkeakkk

SCOP Domain Coordinates for d2i2vg2:

Click to download the PDB-style file with coordinates for d2i2vg2.
(The format of our PDB-style files is described here.)

Timeline for d2i2vg2: