SCOPe 2.06: Domain d2i2vc2: 2i2v C:61-124

Lineage for d2i2vc2 (2i2v C:61-124)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
   incomplete OB-fold lacking the last strand

7. Species Escherichia coli [TaxId:562] [159086] (27 PDB entries)
   Uniprot P60422 3-124

8. Domain d2i2vc2: 2i2v C:61-124 [145484]
   Other proteins in same PDB: d2i2v01, d2i2v11, d2i2v21, d2i2v31, d2i2v41, d2i2vc1, d2i2vd1, d2i2ve1, d2i2vf1, d2i2vg1, d2i2vg2, d2i2vh1, d2i2vh2, d2i2vi1, d2i2vi2, d2i2vj1, d2i2vk1, d2i2vl1, d2i2vm1, d2i2vn1, d2i2vo1, d2i2vp1, d2i2vq1, d2i2vr1, d2i2vs1, d2i2vt1, d2i2vu1, d2i2vv1, d2i2vw1, d2i2vx1, d2i2vy1, d2i2vz1
   protein/RNA complex; complexed with mg, zn
   protein/RNA complex; complexed with mg, zn

Details for d2i2vc2

PDB Entry: 2i2v, 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.

PDB Compounds: (C:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2i2vc2:

Sequence; same for both SEQRES and ATOM records:

>d2i2vc2 b.40.4.5 (C:61-124) N-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
yrivdfkrnkdgipavverleydpnrsanialvlykdgerryilapkglkagdqiqsgvd
aaik

Timeline for d2i2vc2:

• d2i2vc2 first appeared in SCOP 1.75
  
• d2i2vc2 appears in SCOPe 2.05
  
• d2i2vc2 appears in SCOPe 2.07
  
• d2i2vc2 appears in the current release, SCOPe 2.08