SCOPe 2.07: Domain d2i2uu1: 2i2u U:3-53

Lineage for d2i2uu1 (2i2u U:3-53)

1. Root: SCOPe 2.07

2. Class j: Peptides [58231] (148 folds)

3. Fold j.122: Ribosomal protein S21p [161307] (1 superfamily)
   non-globular, mainly alpha-helical

4. Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family)

5. Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein)
   Pfam PF01165

6. Protein Ribosomal protein S21, RpsU [161310] (1 species)

7. Species Escherichia coli [TaxId:562] [161311] (24 PDB entries)
   Uniprot P68679 4-54

8. Domain d2i2uu1: 2i2u U:3-53 [145482]
   Other proteins in same PDB: d2i2ub1, d2i2uc1, d2i2uc2, d2i2ud1, d2i2ue1, d2i2ue2, d2i2uf1, d2i2ug1, d2i2uh1, d2i2ui1, d2i2uj1, d2i2uk1, d2i2ul1, d2i2um1, d2i2un1, d2i2uo1, d2i2up1, d2i2uq1, d2i2ur1, d2i2us1, d2i2ut1
   protein/RNA complex; complexed with mg
   protein/RNA complex; complexed with mg

Details for d2i2uu1

PDB Entry: 2i2u, 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.

PDB Compounds: (U:) 30S ribosomal protein S21

SCOPe Domain Sequences for d2i2uu1:

Sequence; same for both SEQRES and ATOM records:

>d2i2uu1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]}
ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk

Timeline for d2i2uu1:

• d2i2uu1 first appeared in SCOP 1.75
  
• d2i2uu1 appears in SCOPe 2.06
  
• d2i2uu1 appears in the current release, SCOPe 2.08