Lineage for d2i2us1 (2i2u S:2-80)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857955Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 857956Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
  5. 857957Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 857958Protein Ribosomal protein S19 [54572] (2 species)
  7. 857959Species Escherichia coli [TaxId:562] [160144] (26 PDB entries)
    Uniprot P0A7U3 2-80
  8. 857977Domain d2i2us1: 2i2u S:2-80 [145480]
    Other proteins in same PDB: d2i2ub1, d2i2uc1, d2i2uc2, d2i2ud1, d2i2ue1, d2i2ue2, d2i2uf1, d2i2ug1, d2i2uh1, d2i2ui1, d2i2uj1, d2i2uk1, d2i2ul1, d2i2um1, d2i2un1, d2i2uo1, d2i2up1, d2i2uq1, d2i2ur1, d2i2ut1, d2i2uu1
    automatically matched to 2AVY S:2-80
    complexed with mg

Details for d2i2us1

PDB Entry: 2i2u (more details), 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (S:) 30S ribosomal protein S19

SCOP Domain Sequences for d2i2us1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i2us1 d.28.1.1 (S:2-80) Ribosomal protein S19 {Escherichia coli [TaxId: 562]}
rslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvfv
tdemvghklgefaptrtyr

SCOP Domain Coordinates for d2i2us1:

Click to download the PDB-style file with coordinates for d2i2us1.
(The format of our PDB-style files is described here.)

Timeline for d2i2us1: